DPCstruct | MC13563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 140 ± 27 aa |
| Standard deviation of domain lengths | 26.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380NML9 | 105-201 | VCPEVLGGLPTPRIPAEIVDGEVRTRDGQSVDREFRQGAWQALKIAREKQVDVAILQSRSPSCGVKEIYDGTFSGTRIAGSGIFASL… |
| A0A5C7A0S7 | 2-133 | RYDVHHAQLADSELLTQLRTKFTVVSIYPEMLGRLLTLRAPADTVNQQGRIEVVDCDGQLVTDAFVEGARQACVIAKKYQITRALLK… |
| A0A534BZB9 | 2-155 | None |
| A0A7X6XS56 | 5-149 | None |
| A0A521U9C1 | 24-176 | None |
| A0A7S1MSI6 | 120-302 | None |
| A0A2A2KC31 | 221-379 | None |
| A0A353P3W3 | 1-84 | None |
| A0A7X8IXA3 | 141-271 | None |
| K2Q6D6 | 107-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.