DPCstruct | MC13562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 43.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9X2A1 | 135-188 | EAVRVAASALRAARQFTNTAQFTLRCSDCGQALRGEKEAQSHAASRGHVNFVEY |
| A0A427YC11 | 1-60 | MDSTVMEAAEELVGSLKKKHYYTDTATFDLRCGICGTGLQGEKGAREHAMATGHVEFGEY |
| A0A074ZPQ9 | 677-728 | None |
| A0A5B7DCQ5 | 71-130 | None |
| A0A3P7UEN2 | 126-187 | None |
| A0A7S1WXI0 | 254-311 | None |
| A0A5C7IFM7 | 805-860 | None |
| A8QAN1 | 20-87 | None |
| A0A4V3XFH4 | 635-700 | None |
| A0A1Q9F2A2 | 823-879 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.