DPCstruct | MC13561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 97 ± 19 aa |
| Standard deviation of domain lengths | 18.78 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.69 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0023- PF14995- PF01283 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8DP72 | 60-154 | RAKHGRGHVNAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASYYQSYQLPKLYAKLHYCVSCAIHSKVVRNRSKADRRIRT… |
| A0A427XWV0 | 7-98 | GGGRNKKGRGHVKSDKAIKRNSVKNMVEAAAVRDMSEASVYAEYALPKLYVRLAYCISCAIHAKVVRVRSDKPGAINSRKNRAPPPR… |
| A0A662H3T5 | 1-93 | None |
| A0A0F7RWI2 | 2-127 | None |
| R9P3K6 | 144-240 | None |
| A0A7R9KHH3 | 18-100 | None |
| G3II95 | 513-567 | None |
| A0A830GXB0 | 1-117 | None |
| A0A507FL95 | 99-203 | None |
| A0A453FU19 | 28-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.