DPCstruct | MC1356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 190 ± 35 aa |
| Standard deviation of domain lengths | 35.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9LX60 | 80-290 | YFDLLITGIEPEELTWEPVTLGGITATVTNVVAKDWWLPYEDWGVVARVKLTGPEARTQRNNPKPSQIAKPQLPQTFELVGRDIYGV… |
| A0A2C6DIY5 | 199-378 | MDGTSTASNSNYTFAADASAPWVTVNATTGVVKFTGVPSTAQTVNIAITDKRGGPASTFSFRVGTWFINNTPTVGRPADADAWCATK… |
| A0A853N669 | 47-275 | None |
| W0A3X4 | 771-979 | None |
| A0A0H2QRX0 | 110-314 | None |
| A0A1I5BVB6 | 518-705 | None |
| A0A853N5E0 | 31-194 | None |
| E0WUI5 | 90-267 | None |
| A0A1B9KHT3 | 174-392 | None |
| A0A7Y8CT01 | 37-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.