DPCstruct | MC13555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 42.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2U1Z4 | 251-335 | MANHLRFIGRTVMVQNGNVDAAYGALSRILSQDGIIESVKQRRYYEKPCRKRQRLAYEACRRVYNAEMARKISFLARKSRMDPWL |
| A0A553PCW5 | 18-99 | HFYSRTVMVKDDDVDEAMKILNGIMANEGLLKRWKLTRRYEKPTWERHRVNYERTHAIYNEDMGNRIQFILRKRRTNPYPGT |
| A0A7E4RBJ0 | 1-74 | None |
| A0A4S2LHZ8 | 1-95 | None |
| A0A2I3H3A9 | 1-69 | None |
| A0A182MTM0 | 48-134 | None |
| A0A437CWZ2 | 38-121 | None |
| A0A556U8K3 | 453-552 | None |
| A0A337SPF4 | 1-87 | None |
| A0A817VPQ1 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.