DPCstruct | MC13553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 59.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2B988 | 90-138 | FMYEKRSCIRRGGSCDHRPNDCCFSSACRCNLWGTNCRCQRAGLFQRWG |
| A0A553P5X7 | 2-53 | FPNEFVKRRLCIRPTMSCNLRPNSCCPSTTCRCNLWGQNCRCLRMGLFQRWG |
| A0A482WFC6 | 137-204 | None |
| A0A1W7R975 | 13-76 | None |
| A0A026WPB0 | 7-59 | None |
| T1KBA3 | 71-129 | None |
| E2B7Z7 | 12-68 | None |
| A0A6A4VTM5 | 85-147 | None |
| A0A182F3X1 | 4-66 | None |
| A0A336K798 | 12-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.