DPCstruct | MC13552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 216 ± 21 aa |
| Standard deviation of domain lengths | 21.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1TNG2 | 1-204 | MLNKTDVSDQITGLRPKVRQAAVHLAHHLTKEIKKCQGRKGPKAEKFHKKAETYRKEVLLLKKIKEDSVSRYALRMDFSEREKLLGD… |
| A0A6J3K8W6 | 3-211 | INNEIVLLRQCIRQARICVINKLIREAKRLRSGNGNEKQLEKNKNKADKLLREVFALKGIKDDEISKFGITRFKCLQDILQNTHTDD… |
| A0A6J8DN24 | 1-268 | None |
| A0A6S7GR67 | 1-212 | None |
| A0A833VQV1 | 3-208 | None |
| A0A1Y3EHB9 | 1-195 | None |
| A0A2R7X521 | 3-230 | None |
| A0A151M7Z4 | 8-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.