DPCstruct | MC13551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J354 | 9-88 | GIHYIVIFATCMVCYYNSCYCDFVFDDISAIKENRDLKPTTPIQNVFLNDFWGTPMHKEQSHKSYRPLCVVTFRWNYALH |
| A0A553P1H6 | 55-137 | HFFVVFGFVTLVYWNSLTGDFVHDDNPAILQNPMVTDANTSIWNILTHDFWGTQLDSSASHKSFRPITTLVFRLIYSVQISDS |
| A0A833W0S4 | 181-268 | None |
| A0A538NLH4 | 28-125 | None |
| A0A158R279 | 34-127 | None |
| A0A6L5D461 | 2-54 | None |
| A0A0M3IIL1 | 17-101 | None |
| A0A182U859 | 31-117 | None |
| A0A182FV68 | 119-221 | None |
| A0A6J1WVI4 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.