DPCstruct | MC13548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 306 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.56 |
| Pfam Score | 56.42 |
| Assigned Pfam label(s) | CL0220- PF04155- PF01221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183N7Q3 | 1-76 | MPVDMQQDAVDLCYQGIENFKEEYEIAKYLKKEYECKYGSIWHCIVGKSFGSYISHEEDGFIFFHLHGYYVMLFKA |
| A0A553NXJ2 | 20-119 | YAQFLNRTRVAPIVKYCTLGTDASDEALDIILAACELLPWDNLGISNHIKNHLDDRLGTPWHVVVGESFAFEITSEGGDLMFVYYGS… |
| A0A0R3UGQ0 | 25-118 | None |
| A0A0D8X7S5 | 706-826 | None |
| A0A0R3U645 | 645-770 | None |
| A0A0D9V1Z1 | 340-444 | None |
| A0A0N5CVE4 | 81-202 | None |
| A0A0D8XM86 | 2-66 | None |
| A0A504X728 | 2-103 | None |
| A0A2K5NXH6 | 3-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.