DPCstruct | MC13546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 71.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7KUY7 | 6-79 | DSHSRYLKEFRVEQCPLFIQRKCTQHRPFTCFNWHFMNQRRRRPVRKRDRTFNYSADNYCTKYDETTGICPDGD |
| A0A553NUZ8 | 84-164 | NPQTEQVFHYKYLKEFRVEQCPLFLQHKCQQHRPFTCFHWHFQNQRRRRPIRRRDGTFNYSADVYCSKYDETTGLCPDGDE |
| A0A5J4NU09 | 2-72 | None |
| A0A5K4ETY8 | 12-97 | None |
| A0A368GEW4 | 50-129 | None |
| A0A183TIG3 | 4-85 | None |
| A0A7R9LAC0 | 132-208 | None |
| A0A158RF14 | 2-59 | None |
| A0A820TN96 | 6-87 | None |
| A0A7R9EA33 | 167-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.