DPCstruct | MC13545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.92 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0159- PF10269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553NTT2 | 157-290 | SMFFQLKEILRWLGLTVWEIFVFLLAFLLFTILLTLKVELWVDISYWIVFSPLFVCDAFNAYFCVIVLIRMYIETSYKSALLRALWS… |
| A0A077ZG13 | 3-136 | LLSLTETIRLLGVTVFELWMQLAGALIFSVLLVLKMELGLPWSWCTVFSPLFVVSVLNTFFTLIVFLRQYFGEESVKLAAFRLITVG… |
| A0A7M7GKV2 | 16-149 | None |
| A0A4U1EL35 | 1-134 | None |
| A0A0B2VM22 | 1-143 | None |
| A0A0R3S177 | 25-185 | None |
| A0A1J1IYF0 | 1-166 | None |
| S9YLR8 | 10-124 | None |
| A0A3P7Y743 | 16-176 | None |
| A0A7R9F7Q8 | 2-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.