DPCstruct | MC13544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EV24 | 96-160 | DEAAYDNVTFPELREITDYLLLYRVNGLRSVGKLFPNLAVIRGNTLFFNYAFISFEMIHLQEIGL |
| A0A226NNK0 | 182-240 | NFRFPKLTVITDYLLLFRVAGLESLSDLFPNLTVIRGRNLFYNYALVIFEMTNLKEIGL |
| A0A443SM17 | 39-106 | None |
| A0A3B5KX70 | 45-112 | None |
| P14617 | 66-128 | None |
| A0A482WIG9 | 76-149 | None |
| A0A7R8VIW2 | 95-161 | None |
| A0A4C1VFR9 | 82-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.