DPCstruct | MC13543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 202 ± 43 aa |
| Standard deviation of domain lengths | 43.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553NCC7 | 52-267 | FLAQKHRCLTQADLSRKGAIDAGLERLITALNQHPDLATLSSCSGRVVIFREAYTPSGPVRKQGCEWIWLSHDPIAPADSVWTRVLE… |
| A0A2Z2MHK5 | 4-189 | KREALVSLFTAMREGKVDEDIIDLLLLINSINGIYTTSSCSGRIGIIEEPDLGAKPLARWLVKVHRPMEFEEARKALKKAREGLIFL… |
| A0A0B7MVW7 | 2-201 | None |
| A0A3M7HM68 | 130-362 | None |
| A0A7J2LCP8 | 8-196 | None |
| R1D6W7 | 25-203 | None |
| A0A3G1A6B2 | 2-126 | None |
| A0A7M7GR21 | 1-214 | None |
| A0A061D1I0 | 123-393 | None |
| A0A2J8WQ54 | 4-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.