DPCstruct | MC1354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4KC22 | 1-89 | MSTSDKKKLDGFGAASTYALKSDITAMYRYKGSVASTDKLPTSGQTIGDVYDVGNGMNYAWNGSNWDALGEIFTITKITNTEIDTVL… |
| A0A2K9NYV0 | 111-235 | TDLNTTAKGTIVAAINEVKTSADGKMTSAQVDSKITAAKAGLATETYVNNKVSSVYKYKGSKDTYASLPTTGNTVGDVWNVVDKNGQ… |
| A0A316R5R6 | 26-162 | None |
| A0A415UCL1 | 291-388 | None |
| A0A2A7AEX8 | 96-240 | None |
| A0A7G9B8H5 | 16-135 | None |
| R6WL35 | 30-147 | None |
| A0A5N7UVT6 | 69-190 | None |
| A0A1I0BMS2 | 85-226 | None |
| A0A1C6H7J0 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.