DPCstruct | MC13539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 192 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314Y6L1 | 9-202 | AAIAWGWLLEALAGFKEVGVSLLHDLIKMAPDLPEDLETKVNERVALRCLEDLFSPGDVPAPLPSTSTSTHHSKVTFDLSESCDDVL… |
| A0A835VF54 | 1-192 | MASSLLPWKWVIESLAGVPDVGNSVLSALVERFPHVLDDSSGAIKERIALRYLEEFAGTACEETPPPLSTNDASTSSYAAGMNAAQT… |
| A0A061EY27 | 12-187 | None |
| A0A4D9BJ60 | 5-208 | None |
| A0A6A6M3J0 | 1-178 | None |
| A0A438JKY0 | 28-236 | None |
| U5DDB1 | 2-199 | None |
| C5YCC1 | 3-178 | None |
| A0A6D2J3X0 | 28-227 | None |
| A0A7N2ME98 | 10-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.