DPCstruct | MC13536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5Z0Z4 | 57-167 | SSSSEGGRLVDEDMATLRRRIREARAEDDGIFDADVDAGIPLPTEWTELERRHHGSYVAGVRSAVALLEVLLVNTRPGLGAGLLAVL… |
| A0A835VAE9 | 2-100 | GQKVDEDMIVLRLRIHEMRAIERNEEPPSHWMEWEKRCFSSYAADVCMAVGFLQTLLMSTRPSFAVALVLTFALSVTSSGFLLLCHL… |
| A0A4U6VDG4 | 168-287 | None |
| A0A5C7ILI3 | 25-139 | None |
| A0A1E5UK00 | 60-178 | None |
| A0A843WX99 | 58-155 | None |
| A0A1J7HKL5 | 1-109 | None |
| A0A2N9FNU9 | 53-156 | None |
| A0A444CRJ2 | 170-276 | None |
| A0A833R3N2 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.