DPCstruct | MC13534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.89 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0077- CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834LXR8 | 368-488 | DPMSPRLYEDILKEVEQIGVFKYGGLPHWGKNQNVAFEGVINKYGNAEEFLKVKQDYDPQGLFSSGWTDQVLGLRDRVTIVREGCAL… |
| A0A835V7P8 | 2-105 | ALVKYGALPHWGKNRNIAFDSVIDKYPKREDFLKVKNKYDPRGLFSSEWTDQVLGIEGKKASIVKYGCALEGLCVCSEDHHCAPEKG… |
| A0A835EAH2 | 5-132 | None |
| A5L6Q0 | 121-240 | None |
| A0A446K165 | 255-375 | None |
| A0A835RNT9 | 1-114 | None |
| A0A565BPI4 | 12-129 | None |
| A0A7J7QM84 | 897-1019 | None |
| D5AAQ1 | 184-310 | None |
| A0A4S4EJH9 | 250-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.