DPCstruct | MC13533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 375 ± 79 aa |
| Standard deviation of domain lengths | 79.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 69.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 78.92 |
| Assigned Pfam label(s) | PF16498- CL0123- PF00095- CL0229- PF16495 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7MJM6 | 16-322 | PCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQM… |
| A0A835V4C6 | 45-412 | SVHRGLRMAGSLLREDANDSAARLGDLDVRIRESLCEHSCSYCSRPLPSLLYQSQKEAETILCTDCFNDAKFITGHSSLDFVRMDSK… |
| A0A1P8B194 | 1-406 | None |
| H3ADT7 | 1-551 | None |
| A0A0D9VD98 | 268-625 | None |
| A0A0C9RTN0 | 1-295 | None |
| A0A7S2U9H2 | 170-485 | None |
| A0A4Y7IZV1 | 373-709 | None |
| A0A1D2NGI3 | 27-466 | None |
| A0A0K0DZD7 | 7-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.