DPCstruct | MC13532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835V3F7 | 1-108 | MCAPRSVYSWDIVIQRVGNKLFFDKRDGSQLDLLSVNETSSEPLPEAKEDINSAHSLSVEATYINQNFSQQVLVRDGNKVTFDEPNP… |
| A0A0C2GDF1 | 150-246 | MTAPRSVYSWDIVAHRVGDKLFLDKRDTGGISNPVDALTVSETSGDPPSFEGAGINNAKDLATEALFINQNFRRQVLKRNEHPYVMA… |
| A0A368FZY0 | 525-620 | None |
| A0A482S574 | 152-230 | None |
| J9EAC5 | 1-82 | None |
| A0A815JL73 | 210-284 | None |
| A0A819S121 | 396-470 | None |
| A0A815PGL0 | 137-217 | None |
| A0A183HFE8 | 8-100 | None |
| A0A1I8GHA0 | 279-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.