DPCstruct | MC13531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 225 ± 37 aa |
| Standard deviation of domain lengths | 36.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KXG3 | 5-195 | ELITQDRDFFPKLLDIFRMCEDLENLDDLHMIFKLVRGIILLNSPSIFEKIFSDEFILDIIGALEYDPEVAKVQKHRIFLKDHVVFK… |
| A0A835V3E5 | 6-258 | GQHMHCTEDLHFTSLNNESFHAVNNALKDFPPIHISTLPLILKAVVECGITDQMRVIELILQDQNFFPKLIDLFRMNEDLSNLETLH… |
| A0A2H3EJH9 | 159-317 | None |
| L9JD97 | 119-364 | None |
| A0A7S1F9H8 | 116-334 | None |
| A0A1V2LMU7 | 149-343 | None |
| M2RUX8 | 109-355 | None |
| A0A1S8W5J0 | 287-515 | None |
| B0EBC4 | 263-525 | None |
| A0A6F9C5Z8 | 577-835 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.