DPCstruct | MC1353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 13.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4RYH1 | 61-179 | YPQSQGVNKQPDFIFTTDGCSRAPDVHWLACCIVHDISYWCGGSQTDRAAADYLLKQCVTHQSGVMASVFYSGVRMGGTPWLPTPWR… |
| A0A1Z8VLV8 | 4-103 | AEFSSDGCSLFLDGNFEDPKLWKECCVLHDIAYWRGGSKKEREEADQAFKHCVEKKTGNSKLAALMFQAVRAGGEPYFPTWYRWGYG… |
| A0A849WU11 | 35-166 | None |
| A0A350SKJ4 | 38-148 | None |
| D8K7G4 | 24-144 | None |
| A0A0F9HX85 | 46-147 | None |
| A0A3N2DPM6 | 16-134 | None |
| A0A5J6NXX5 | 14-148 | None |
| A0A521FZ12 | 20-125 | None |
| A0A1Y5F4Y3 | 5-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.