DPCstruct | MC13529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 13.68 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5XQ92 | 123-216 | LFQALIECLVGMKISTVNQTEGLCILALHQSSGYSFSLTWINKTSGEEAELVYRVLSLGTFERVAPEWMRDVIMFSTNMCPIFFERL… |
| A0A835UWZ7 | 35-123 | FHTLVELLVGMKFSVEHHSEGLCVTVTHQMSGYSFTLSWVRDKEEAEQELVYQVFSLGTIEGIAKQWMKEDIVFSLAMCPVFFDRLS… |
| A0A251SHN5 | 229-345 | None |
| A0A7J7MZD4 | 19-88 | None |
| A0A2P2J659 | 21-111 | None |
| A0A2P2J630 | 146-264 | None |
| A0A804IDK6 | 164-269 | None |
| D8S9U4 | 378-474 | None |
| A0A7J6VAR4 | 361-452 | None |
| A0A067DHY1 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.