DPCstruct | MC13527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 189 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520MJ83 | 1-190 | MNEKIKYFIAGLFIGLSELLPGISGATVALMFGVYEKILNFLSRFKDFNLILPLIIGMIISVLSFSNIIDFLYKNYTDIFNFLIALL… |
| A0A1Z9F422 | 6-204 | NSIRQNSNEGLNNADDVIENQSFKQIYLKGLVMGLSDSVPGVSGATIALITNIYERLIAAIASVNLFTLCYLLTQRRGHVWRNIDGN… |
| A0A2E9FHD2 | 4-200 | None |
| A0A7Y2YZ75 | 261-455 | None |
| A0A7C7Z8Z9 | 31-198 | None |
| A0A150NMG2 | 4-186 | None |
| A0A1Y3RKH7 | 22-177 | None |
| A0A3M2FWF1 | 4-216 | None |
| A0A357HCK7 | 84-326 | None |
| A0A2E3HRE0 | 327-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.