DPCstruct | MC13526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 162 ± 23 aa |
| Standard deviation of domain lengths | 23.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8EKI9 | 7-153 | SNRIRTFTGKYIDVFNPDPEMICIEDIAHALAQTPRFGGHLKHFYSVAHHSMHCSELVRNDKLAALLHDASEAYLTDMPRPIKMQMP… |
| A0A4U2U926 | 3-129 | WITTFSGRHFDYADPDINSICITDIIHALSNECRYAGHCSQFYSVAQHSVLTSMIVPPAFALEALLHDAAEAYCKDIPAPLKRLLPD… |
| A0A381GCG7 | 1-97 | None |
| A0A839DAD4 | 377-510 | None |
| A0A2W5LV46 | 3-177 | None |
| A0A7W6R216 | 118-289 | None |
| A0A1G4WX79 | 2-173 | None |
| A0A1S7S6Z3 | 12-213 | None |
| A0A5C7Q8I5 | 33-203 | None |
| G0JLZ9 | 4-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.