DPCstruct | MC13525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 377 ± 81 aa |
| Standard deviation of domain lengths | 81.43 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.88 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF18211- CL0276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4IDV9 | 63-343 | IKDYYIRLEGLNIDSGVLDTNQISVVRGAGLLLRQAAKDAAQTIANQPGSSVISTGASIGEFRVGTNDATQVAGLISDIQQQVSSGD… |
| A0A3M8EGG9 | 9-339 | YLYGAAVQGIQGFIFQTNKLREIVGASELVEEICTDMFVGLFTKAKINYKDENCILHAAGNIKYMFDNEEECKKIVRIFPKMVAEFS… |
| A0A1W9TNG8 | 630-1027 | None |
| A0A3B8QC27 | 8-345 | None |
| A0A2H5WUU8 | 208-553 | None |
| G6FQ90 | 292-667 | None |
| A0A4V5SPL5 | 1-336 | None |
| A0A1E8F0U6 | 136-466 | None |
| A0A6L4ZLN7 | 523-1126 | None |
| A0A2R6ALI9 | 1-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.