DPCstruct | MC13524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831KIE0 | 2-82 | ARKCYEICQRVLPRYSNRMGPKKYEFWQLIAMYLYGLIYNLTYRDLEEEFLVSEVLREALNLKDVPHYSTICKAVKRLKEE |
| A0A2Z4LAG1 | 1-108 | MPRHETPSLYQLSKIEKVDLTGNMMLDFVLTAYNYAKLTFKKYSSQYSKQKYTQPQLFAILAYKTYNKYDYRNTIENLKISTKLQKA… |
| A0A1N7GVR6 | 5-92 | None |
| A0A166CE86 | 34-131 | None |
| A0A166C832 | 14-108 | None |
| A0A1D2V0S9 | 1-86 | None |
| A0A4V0I6N0 | 3-87 | None |
| A0A2M8Q9D9 | 1-95 | None |
| A0A842Q528 | 1-87 | None |
| D7BIU2 | 6-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.