DPCstruct | MC1352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 31.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5WDP4 | 1-119 | MKFFNHPHKDMVLRSDKKIMPLLNAKEKIDDIGGIACKTCHEPHFWSAKIQKNALQSKPKTILSLGQTDNVEGSPLNSFLRTEGVKG… |
| A0A1X7MMJ6 | 145-257 | HPYQDMVLRSGEKIMPVLEKEHEEIEGIGVISCITCHEPHSWKPLKNPEEKNYPVLDYKKQENIEGDIKNSFLRHKGVAGTFCVDCH… |
| A0A1G2ZXT9 | 378-495 | None |
| A0A7V1BW76 | 1-92 | None |
| A0A7C4C9B1 | 103-206 | None |
| A0A832FHQ8 | 1095-1217 | None |
| A0A7C3E7I8 | 590-681 | None |
| A0A7C5CQ68 | 814-926 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.