DPCstruct | MC13519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z2KFI0 | 5-170 | ALFFEQWNKLIYTADILHNYAQRIYEERQYYKAKGLAIPLIKMEHPLVYYFGFSQQMRGIAYQKLERYEQAKDSIYRYAELGWIEDL… |
| J2GJH3 | 1-134 | MGGILETERHLVVYYGQGFLLKGLALQLQERYEEAISCVQEYAELGWFKFRDELAEMEIEKFRGWAKANHYTLNLLMGRTELLSEYV… |
| A0A4Q4IJ31 | 75-274 | None |
| A0A259TBF5 | 10-196 | None |
| H6CQD0 | 95-303 | None |
| A0A2W6NBD1 | 38-252 | None |
| A0A2S5I2T0 | 22-223 | None |
| A0A069DM55 | 21-196 | None |
| A0A4U3FBK0 | 201-392 | None |
| A0A2Z2KI40 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.