DPCstruct | MC13518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 221 ± 29 aa |
| Standard deviation of domain lengths | 28.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 38.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5C0J7 | 12-220 | KPLGNETVSRAAYNENLDILDGNAAKADDLVTHQTSATLDHPNDSVTDAKIGNRTVSDSTAPTGDTGSPTTIFGWLANRIKAITGKT… |
| A0A351AZC7 | 20-228 | DWNWWSVNTDQIEADLAALRKVINPGDPGGGIDDTNIVNGGITASTKLVNLSVTAEKIADGAATDAKIGNRTVDPLLAPASSTGTLT… |
| A0A089M975 | 1-259 | None |
| H3SA96 | 14-225 | None |
| A0A7G3E6R5 | 3-179 | None |
| A0A7G3DW35 | 1-265 | None |
| K4ZL21 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.