DPCstruct | MC1351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 370 ± 56 aa |
| Standard deviation of domain lengths | 55.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9LAQ8 | 300-596 | LLAAARTWLSDLARAGWQGIDHDLAGGAAPIVSAMLPHPELRRLGTLLDGFAAELAASCPGAALERIPARRWGDLWSRALLLTRPGA… |
| A0A519MIZ4 | 36-397 | FQATTPPAWVSEWLGSRADKAQQKEVRQAEKAAAPVDEQAQAKREAQRWQRMETAAQELQRWLCDQVSRGLGSLNAEVLQTWQTMAA… |
| A0A5C7YEF7 | 243-668 | None |
| G2DXX7 | 177-536 | None |
| A0A1I1VV53 | 89-433 | None |
| A0A847KKN0 | 33-476 | None |
| A0A2A6L8J6 | 232-550 | None |
| A0A1W6DQJ9 | 32-405 | None |
| A0A6I3EVF7 | 206-594 | None |
| A0A372JGL4 | 1-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.