DPCstruct | MC13509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 3.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 84.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3QYV4 | 4-56 | NTTLNALICRHARDLLLAQGWPEETDVDQRNPKYPGWISIYVLLDAPRLATLL |
| A0A2H5C9E9 | 1-48 | MNETLNALICRHARSLLLAQGWPEETDVDQRNPNYPGWISIYVRLDTP |
| A0A271QV24 | 4-56 | None |
| A0A4C3PXA4 | 1-54 | None |
| C1J8T2 | 1-54 | None |
| A0A839LBP2 | 1-55 | None |
| A0A827DQZ3 | 4-56 | None |
| A0A377CXJ2 | 3-56 | None |
| A0A379YKZ6 | 1-58 | None |
| A0A222QV47 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.