DPCstruct | MC13502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 144 ± 29 aa |
| Standard deviation of domain lengths | 29.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L3GJS8 | 3-111 | GCMNPYASKFACPDPDNGKCVSMEDAYTESMESRLDPARPQRRADSSEYQDALLGRIAGLLREPETPVVVPPKVMRVLMLPYEGEGN… |
| A0A0Q9YHX0 | 1-110 | MKKRSLLVFLSILALSGCTASLRGQFDCPGTPGVQCKSISEVNRMVDKEIIPEQKNLDKQILGTNEKSLRRSKEEVLTVWIAPFEDE… |
| A0A1X1EKX1 | 33-180 | None |
| X6Q7Y2 | 4-104 | None |
| K1YUJ1 | 6-174 | None |
| R7KK09 | 1-145 | None |
| A0A7Z3CSU8 | 13-153 | None |
| A0A840YHH8 | 3-137 | None |
| A0A4U6PCB0 | 14-155 | None |
| A0A2G5QXZ9 | 3-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.