DPCstruct | MC13500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 216 ± 28 aa |
| Standard deviation of domain lengths | 27.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3ZPX5 | 7-209 | RMPAMRLALVVALATAEVKVETKPKPCKKFKCYGRKDPAPRSPYFAPRGTGACPEGASPHLAKCCAERDACATICGITEELCKKAFD… |
| A0A7S2X7Y0 | 1-192 | MGLMEDDRACKMFKCPQGSTAVRKPKAQFRSAGCDAISRKVSLPPSSDHTELTECCDVRMACQSICGIRSRVCDNRFKKCAENTCRR… |
| A0A1E7EU67 | 2-204 | None |
| X6M7N5 | 29-192 | None |
| A0A421FQ78 | 92-294 | None |
| C1E6D1 | 8-228 | None |
| A0A5J4Z298 | 63-293 | None |
| K3W651 | 1-174 | None |
| A0A7S4R528 | 3-271 | None |
| A0A813HST6 | 15-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.