DPCstruct | MC1350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 73 ± 3 aa |
| Standard deviation of domain lengths | 3.20 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9NDA6 | 12-85 | TENKSFFDLSIYEYIGCIGVLESDIKKLDLYNHWCKVSRGSTMLCVTHDSGESDNLVYLYDWEKFSHIYINTGN |
| A0A3R7SCI3 | 2-73 | TNRTFFGLPVVRGLVRQSDIEALPFWEFWLESAAGSTILRDSTTGEQMIYLHDWERFCRLFIATGRHRYSSM |
| A0A2K0XVY0 | 1-73 | None |
| A0A2S9TGI3 | 152-221 | None |
| A0A3M6RQR1 | 3-75 | None |
| A0A7C5D6V3 | 9-77 | None |
| A0A654D3A8 | 96-167 | None |
| A0A0Q8BID4 | 2-71 | None |
| A0A6F8QDI1 | 286-361 | None |
| A0A2N1Y546 | 73-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.