DPCstruct | MC135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9EH15 | 315-395 | SKQILDLDSPEGYKRINLIEGHHLYGATTKSVNVFGEEQEEIAWDLIDSIPKELITLDDHLFRVFFDSEKETVPGIEVLKK |
| A0A842TQV0 | 1-82 | MSEEILNKFEDTPEGYSREGVIIPPDYYAVIEKKATIMGKETVKREIEKTESLPQGFIFSPDYTPRILIENGEVVAIEILKK |
| A0A850M9S2 | 110-195 | None |
| A0A1Q9N0Y3 | 183-263 | None |
| A0A5B9DDP2 | 148-231 | None |
| X1BCH4 | 8-101 | None |
| A0A7J3NRU6 | 176-277 | None |
| A0A842RYD6 | 141-222 | None |
| A0A850M014 | 111-189 | None |
| A0A497QIL6 | 238-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.