DPCstruct | MC13497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 24.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F0RSY7 | 62-228 | LPQKDRISYFAQAEKMAITGVAIKTKPVLARPAKEGEVITTYIKGEGVETISEPAKAGDWVVQNICPATGNEEILVRKDKFAQRYNL… |
| A0A7S2U2S2 | 165-295 | EKTAQLYVKTATVYAFKTADACQVEKEWGRQSGKDGCWIICNPQEDDLYLVDETTFGRNYKKLKSQEHQFRKVGAVWARQMDKPFAL… |
| A0A7I8CR08 | 2-98 | None |
| A0A7X7IH45 | 174-337 | None |
| A0A812LGS4 | 546-721 | None |
| A0A559QTW5 | 3-130 | None |
| A0A1A2DVA3 | 57-181 | None |
| A0A2U1BGE4 | 1032-1200 | None |
| A0A7S1FEK4 | 460-635 | None |
| A0A1Q6QHQ7 | 136-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.