DPCstruct | MC13494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 169 |
|---|---|
| Mean domain length (aa) | 185 ± 44 aa |
| Standard deviation of domain lengths | 44.00 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0023- PF09369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0V052 | 7-159 | KKFPSMETLKEEILDKEHIYAFKTKGVSLEIQPVSHWSEAQNAEAFHAIEHAIISAAQVVAGLAPTDLGGVSFPSGHIYIYDSYPGG… |
| A0A7S2TV65 | 38-230 | EQPAATINMGLVHAQHGRVMVTTSVFAYHKISNKTHVVMETVPLHLPPIQVQTKAFWLDIPVWVQVLCHKKGLDFKGGIHGAAHAVA… |
| A0A1Y2HCI9 | 679-912 | None |
| A0A0D0QK29 | 246-532 | None |
| A0A376E1Y4 | 887-1084 | None |
| A0A4Q3JWD5 | 299-514 | None |
| A0A7X7HJV4 | 775-1018 | None |
| K0TM93 | 1048-1232 | None |
| A0A443N3Y9 | 47-252 | None |
| A0A7C5ZWD1 | 760-922 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.