DPCstruct | MC13493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 237 ± 20 aa |
| Standard deviation of domain lengths | 20.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DLE8 | 22-247 | KKKPPWPFKKLQRGGKHHSNPLPMGGDDFEERKRDFARTVAPKLDSGLLVVTPSASDPTAWSSSKHGSTGDMSKEVVDAAFEEFSVW… |
| A0A7S2TPR6 | 27-251 | RGRGHSDDSDDTTWPFPKLKDHGIFPYSQAEQSALDERKSDFCRIAWTMTDLLVATPEAPIPEVWKYPGFEKKKESAHKEEAEQMFQ… |
| A0A7S4Q3S9 | 42-283 | None |
| A0A6T0XQK7 | 2-260 | None |
| A0A1Q9DBE6 | 57-344 | None |
| A0A7S2NYA8 | 5-228 | None |
| A0A7S0LGJ7 | 61-267 | None |
| A0A813HGN9 | 281-504 | None |
| A0A813H6V5 | 656-889 | None |
| A0A7S4W3D9 | 21-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.