DPCstruct | MC13490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 478 ± 119 aa |
| Standard deviation of domain lengths | 119.02 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0245- PF02734 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6PUU5 | 24-467 | LEVTGDAGCLLIVKNYTGDRLNFGLAAEQARALGKNVELVIVADDIALGQGVHARGIAGTVLVQKIAGHAADAGASLADVKQIALDA… |
| A0A7S2TKY6 | 2-461 | NFRLAAEQAIAEGIPVEMVVVADDCALPSSKGVTGRRGIAGTALVHKVAGGAAEKGGDLQQVTAEAKAATGAIASMGVSASVCHVPG… |
| A0A6A4H208 | 1-718 | None |
| A0A0J7K6X1 | 2-317 | None |
| A0A3P7J250 | 2-288 | None |
| A0A7V0T5S0 | 137-571 | None |
| A0A4U0VQW4 | 41-624 | None |
| K8FCA7 | 330-1032 | None |
| A0A811MW39 | 29-341 | None |
| A0A482VFX5 | 21-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.