DPCstruct | MC1349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 168 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2JN12 | 12-183 | IDKSPATSMQKDYARSLGITLPEVATKSDAKALIDLELDSDEPASEGLKAFAIEKGMKFSDYVGNKYLHNLLFDNLEALDKVIFFCF… |
| A0A2N1U8V9 | 50-222 | VAPPTESQLSYAKDIGIAVSDNATWEDVRDMISCCVDHDKPATERHKSFAQMYGIEYTEYVGKKRLFAMIFAALQDPSQIIDMISWF… |
| A0A3A9D6T3 | 148-301 | None |
| A0A1T4JPX1 | 49-222 | None |
| B3QPI9 | 1-179 | None |
| A0A1G6KQE9 | 3-179 | None |
| A0A840URG3 | 49-232 | None |
| A0A6M8VJM4 | 2-161 | None |
| A0A1Y4BBM7 | 190-347 | None |
| A0A3E2T6C0 | 196-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.