DPCstruct | MC13489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 214 ± 50 aa |
| Standard deviation of domain lengths | 49.97 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | PF08711- PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0MPD6 | 6-134 | NSIKDFLISCSEDDNKSNKSSKPATKKLENLDLFTKTLLNKKNQDILLDDNILGVVRMWLEPLPDKTLPNINIRKRLLEVLKVINVD… |
| A0A7S2TK72 | 169-480 | GRRRRRRDDDDGEDFDENDQGGSARPERSSMPKTHTDEVFNRIKNENRKKRKKVDEVQLEEDAKEFCQRMRDACDTDRASVEVGEPG… |
| A0A2U1QHH6 | 774-975 | None |
| A0A482VPZ5 | 2-174 | None |
| K3WAV8 | 152-292 | None |
| A0A7R8XA88 | 70-333 | None |
| A0A022QP50 | 186-388 | None |
| A0A2P6NQD6 | 105-320 | None |
| T1EWZ3 | 234-442 | None |
| T1H9Q2 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.