DPCstruct | MC13488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 739 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Standard deviation of domain lengths | 13.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.51 |
| Pfam Score | 99.43 |
| Assigned Pfam label(s) | CL0023- CL0713- CL0105- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2TJL1 | 13-101 | EQHDTADRMPEQKQYTIAEVAKHNKNDDCWIIINGGVYDVTKFAKYHPGGKKILLKEGGKDSSKKFKMFHGGHVLKKYDKKLKIGTV… |
| A0A0K0FG29 | 2-80 | TTFTASEISKNNTPRCLWIIYKGNVCDITDFYPNHPGGSALLKYAGKDITKIMSNVPLHNIAMSKINKVLEERIIGQLK |
| A0A7L4PFQ1 | 106-179 | None |
| A0A7R9T3K4 | 21-111 | None |
| H0EHI8 | 2-89 | None |
| A0A7R9PNY1 | 2-98 | None |
| A0A7R9PW79 | 24-123 | None |
| A0A1V2LN82 | 492-561 | None |
| A0A654HCN2 | 3-90 | None |
| F4QAG4 | 127-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.