DPCstruct | MC13486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2R111 | 137-259 | RTDINSDFAGIYPWDWVGDDIASFKAIQGGLLVAPILQKLILNRVPVETLDFADRVAQWDIETIIPAHLQNNLKYTGKDYRKAFSFL… |
| A0A7S2TEY5 | 23-133 | AWEPGYKASFRAIADKLIVSPVLRFLVFSKSPKKTRQWVDKLARWNFRYIIPAHYAAPIKASALDLKTAFSFAYEGLPEGLLYKALD… |
| A0A7S2R2G4 | 3-105 | None |
| A0A7S1T1T3 | 122-253 | None |
| A0A7S0GD98 | 25-128 | None |
| A0A6P0VB42 | 1-124 | None |
| A0A6U6I6M7 | 43-174 | None |
| A0A1Q9CVA2 | 825-993 | None |
| A0A7S0HE48 | 2-97 | None |
| A0A1Z9JDH4 | 46-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.