DPCstruct | MC13485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 207 ± 40 aa |
| Standard deviation of domain lengths | 39.90 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YUX8 | 1-195 | MKADILDGVTFRVGLLAALRTRKMSGKAIGIMVTASHNPAPDNGVKVVDPMGEMLEQDWEAFATKLVNCPTDEDLAEQYKSLAEQLN… |
| A0A4Q9LT95 | 1-204 | MQSDKKSVQKIFENLPTFLKKTDKKYIYEPSGLRGNASDIIYAVCRTSIVAYIRSSTFCGKMIGIMITASHNPIEDNGIKICDHNGE… |
| A0A397FA29 | 346-519 | None |
| A0A843WMD3 | 5-139 | None |
| A0A5P1EV04 | 7-166 | None |
| G4TY38 | 4-198 | None |
| A0A4T0HGB2 | 17-232 | None |
| A0A183VX87 | 2-224 | None |
| A0A1W0E667 | 18-271 | None |
| A0A6V2AI10 | 55-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.