DPCstruct | MC13483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 88 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9QBF7 | 2-89 | SNFYLTRGVNNRVAEEENFAKFVLKSLRRHFNNDFSECDPEDAETNRESLKDGSRIFTVYNFNPDVKIWIITEAKPYRDRTTVLFPDE |
| A0A1G3ZK91 | 2-82 | ALTPGARSALDLAESSLHRLLSRHERGDWGLLRDDDARENEWALTHGHPVCSLFALPTGAQVLFITEGRRALTSVLLAGED |
| A0A5C6FBZ5 | 153-245 | None |
| A0A1V5RKE7 | 2-95 | None |
| A0A0E3BB53 | 4-72 | None |
| A0A1F8MVV9 | 8-91 | None |
| A0A8A9ZWI8 | 295-389 | None |
| A0A0A8WNU1 | 69-154 | None |
| A0A3R7HR64 | 15-102 | None |
| A0A2V4W523 | 31-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.