DPCstruct | MC1348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1UY98 | 1-78 | MNCWEATKCGKEEHCAAYHAVSLDGFLGGKNGGKACFFILGTRCKGGFQDTKEAKEATCNTCDFFHSLKKQYGELISN |
| A0A2N1U679 | 2-86 | KVNCWEFRKCGRQPGGTKVEEFGVCPAAISKEHNGKNGGQTGGRYCWKAKGTLSDIHTKNNKTEKILKCIACEFYKLVQDEQGSC |
| A0A0F2ISI0 | 15-111 | None |
| A0A2H0NYW8 | 3-81 | None |
| A0A1F6PKW2 | 3-91 | None |
| A0A3D6BWE2 | 5-78 | None |
| A0A661QUB0 | 4-87 | None |
| A0A109CBJ8 | 80-171 | None |
| K1YBW3 | 5-90 | None |
| A0A522URE4 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.