DPCstruct | MC13477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 212 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423N014 | 2-204 | LAWLHAAMLLGAYLLSRWCVALTLGLPAKDFDGAVAIMTILCACLVYLAMILLGCMAVAIGCLILAPVLESAWLISTFPEGERLRQY… |
| W1RXP8 | 119-311 | FAMVLMILTENYIYQTLKKSMWGKGVLSVIVAVYSALAYIWASGEVNSIFLEAPGIFPWTITILTVVHFFKNVVIGVMGSYFIFLLL… |
| A0A1X0N494 | 54-291 | None |
| A0A653AXU8 | 78-311 | None |
| A0A6G9WJR3 | 69-248 | None |
| A0A850N938 | 115-345 | None |
| Q4ZW70 | 138-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.