DPCstruct | MC13475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 345 ± 49 aa |
| Standard deviation of domain lengths | 49.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522F894 | 654-918 | KCGNPDGEFVGFMDDCTPVRVKQDSLNRMSIKPDRVWFRLDTVFINLNQTKVFNGCADNRSYCGYDLPSAKSTFSWFAITKALNGVY… |
| A0A1Q2T7W4 | 125-510 | FSPLKYWKLGDDWFQFKAAKAFAFNRKYFHAVRQMVNGCVLWFNELANSTDNGGDAFNLVAYDIVDAEAPNYDTGELNVIDKNVFAK… |
| A0A3D2IL09 | 2-353 | None |
| A0A140NRK6 | 2-340 | None |
| A0A174TED3 | 385-759 | None |
| A0A1L7MZ85 | 97-371 | None |
| A0A2A2KLY5 | 457-794 | None |
| A0A417DP47 | 220-626 | None |
| D1YJ52 | 4-269 | None |
| A0A3M5LM02 | 3-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.