DPCstruct | MC13473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6GU38 | 53-214 | FPARWHCGRWTDFHGWLYIGSDFAIWAAYFIIPLLLIYFIRQRGDVPFNRLFWLFGLFIAACGATHLLDAVIFWVPLYRLSGLVRLI… |
| A0A848UX75 | 13-175 | DTSDWPPRWYCGTWSDFHGWLYILSDIAIWGAYFAIPVIIIWFIQKRPDIPFLPVFWLFGAFIVLCGTTHIIDALIFWWPNYRIGAL… |
| A0A7U1E7L7 | 2-177 | None |
| A0A426X5J4 | 1-160 | None |
| A0A3M2D1A6 | 11-176 | None |
| A0A2E0EMK6 | 7-132 | None |
| A0A846DX24 | 10-151 | None |
| A0A833LNS7 | 1-165 | None |
| A0A1H4WSS1 | 5-157 | None |
| A0A1R1R6U8 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.