DPCstruct | MC13472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 95 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q1FVY6 | 2-66 | KWEYCTLEWLWNSSQIKINYPSGNEKLSQGSYNEIVNTLNELGAEGWESVNCVSGGNWLFWTLKR |
| A0A848UW17 | 49-149 | EKVAPEQVDKSLMANDNVYIELVVSSGNAGANIKLDLGEYKMVVKDKNLAVALESARAKRYTSAAQALNQLDQLGFEVASTYNLTVR… |
| G6AFY9 | 8-126 | None |
| A0A0F8P6E7 | 1-69 | None |
| A0A2M8P275 | 111-192 | None |
| A0A1X1MIZ1 | 34-101 | None |
| A0A4Q4KNK1 | 1-107 | None |
| A0A1Q6Z169 | 66-158 | None |
| A0A2I4CB89 | 265-367 | None |
| A0A6B9Z528 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.